From mboxrd@z Thu Jan 1 00:00:00 1970 Received: from wout2-smtp.messagingengine.com (wout2-smtp.messagingengine.com [64.147.123.25]) by mx.groups.io with SMTP id smtpd.web11.5383.1678824316125381899 for ; Tue, 14 Mar 2023 13:05:16 -0700 Authentication-Results: mx.groups.io; dkim=fail reason="signature has expired" header.i=@bsdio.com header.s=fm3 header.b=I8fJ74Ga; spf=pass (domain: bsdio.com, ip: 64.147.123.25, mailfrom: rebecca@bsdio.com) Received: from compute6.internal (compute6.nyi.internal [10.202.2.47]) by mailout.west.internal (Postfix) with ESMTP id 4938C3200B65; Tue, 14 Mar 2023 16:05:14 -0400 (EDT) Received: from mailfrontend2 ([10.202.2.163]) by compute6.internal (MEProxy); Tue, 14 Mar 2023 16:05:15 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bsdio.com; h=cc :cc:content-transfer-encoding:content-type:date:date:from:from :in-reply-to:in-reply-to:message-id:mime-version:references :reply-to:sender:subject:subject:to:to; s=fm3; t=1678824313; x= 1678910713; bh=24iztKDmXLNfqWS2OdMs3vkuAlwIIh83MucYMJxjvGw=; b=I 8fJ74Ga6QX1HdAtoZYYzu4nDzcH3OSwOR1rSR464DOsrOoX8PqKOk6hyBPU/apO+ NM9roP7x71Fzs9Pr2jvyxFHKNLJhdFXFNryIv2D2xLe26K8DL37QB5DK4AecVApf ii38B8j0Kl/L82zDdyzm1ZPOr0ODONUUwD8FGhM/RF1frJOCBgOWsfnhnYNhOQrh 60D+kxTmhvC9n/v7VxxfGzpZvzFepP8M1yq25gn3NpaL7dpeLZJNx6Cu3tWFZNKY 7Nt9xD78weesytqg2qSI9D6mH9OFvTt2uc/cn8WjXT+ZAQXeFtZC9NNPN5LdH3/Q u3fUDaCPwE/2ZQ4xRpnHA== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-transfer-encoding :content-type:date:date:feedback-id:feedback-id:from:from :in-reply-to:in-reply-to:message-id:mime-version:references :reply-to:sender:subject:subject:to:to:x-me-proxy:x-me-proxy :x-me-sender:x-me-sender:x-sasl-enc; s=fm2; t=1678824313; x= 1678910713; bh=24iztKDmXLNfqWS2OdMs3vkuAlwIIh83MucYMJxjvGw=; b=g fmrKBqsEyBODj7Dd46ogS9Pa2Lyj/jNVFjPOxSC7/KyfmpCACkWTO5ja+LIhdLQd eHiPzlm3EnEfQ18tWLemtU7mIawEmAPSufOARLzrw00YqgUaEgVqusXhf7FSIaWZ hi7mkntcRL/B/zh2VIsqv1XuEh1RznXIMowCfg+XLjxhO1qSQh6N6DPwe9aVTDe5 hezfRKzO4/Mib9VB+P7fxEE5iQJ6QoLiDSEWR1GRK/f/DBP9b5h/Zp1tbzKOUHYo j87xwHjFdux85yuU/C6xytnwHkJP8nuFzJwRv/HNI5ZcWhpoVX9yWgrFRp6WUPfO h1VL/wdH3EA8AHsGBPEoQ== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedvhedrvddviedgudefiecutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpqfgfvfdpuffrtefokffrpgfnqfgh necuuegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmd enogfuuhhsphgvtghtffhomhgrihhnucdlgeelmdenucfjughrpefhvfevufffkffojghf ggfgsedtkeertdertddtnecuhfhrohhmpeftvggsvggttggrucevrhgrnhcuoehrvggsvg gttggrsegsshguihhordgtohhmqeenucggtffrrghtthgvrhhnpeeijeekieeugfetiefh uddvtdetiedujeetudffteefhfduueejhfetkeehjeeifeenucffohhmrghinhepghhith hhuhgsrdhiohdpthhirghnohgtohhrvgdrohhrghdpghhithgsohhokhdrtghomhdpvggu khdvqdgsuhhilhgushhpvggtihhfihgtrghtihhonhdqughrrghfthdrmhhosghipdhgih hthhhusgdrtghomhdpvggukhdvqdguvggtshhpvggtihhfihgtrghtihhonhdqughrrghf thdrmhhosghipdgvughkvddqihhnfhhsphgvtghifhhitggrthhiohhnqdgurhgrfhhtrd hmohgsihdpvggukhdvqdgushgtshhpvggtihhfihgtrghtihhonhdqughrrghfthdrmhho sghipdgvughkvddqfhgufhhsphgvtghifhhitggrthhiohhnqdgurhgrfhhtrdhmohgsih dpvggukhdvqdhunhhishhpvggtihhfihgtrghtihhonhdqughrrghfthdrmhhosghipdgv ughkvddqihgufhhsphgvtghifhhitggrthhiohhnqdgurhgrfhhtrdhmohgsihdpvggukh dvqdhvfhhrshhpvggtihhfihgtrghtihhonhdqughrrghfthdrmhhosghipdgvughkvddq mhgvthgruggrthgrvgigphhrvghsshhiohhnshihnhhtrgigshhpvggtihhfihgtrghtih honhdqughrrghfthdrmhhosghinecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghm pehmrghilhhfrhhomheprhgvsggvtggtrgessghsughiohdrtghomh X-ME-Proxy: Feedback-ID: i5b994698:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Tue, 14 Mar 2023 16:05:11 -0400 (EDT) From: "Rebecca Cran" To: devel@edk2.groups.io, Ard Biesheuvel , Bob Feng , Abner Chang , Jordan Justen , Liming Gao , Leif Lindholm , Michael Kubacki , Michael D Kinney , Miki Demeter , Ray Ni , Vincent Zimmer , Eric Dong Cc: Rebecca Cran Subject: [PATCH tianocore-docs 1/2] Readme.md: convert links from Gitbook to Github Pages Date: Tue, 14 Mar 2023 14:04:51 -0600 Message-Id: <20230314200452.72564-2-rebecca@bsdio.com> X-Mailer: git-send-email 2.37.1 (Apple Git-137.1) In-Reply-To: <20230314200452.72564-1-rebecca@bsdio.com> References: <20230314200452.72564-1-rebecca@bsdio.com> MIME-Version: 1.0 Content-Transfer-Encoding: 8bit We no longer publish documentation to gitbook.com, instead using tianocore-docs.github.io. Update the links to point to the correct locations. Contributed-under: TianoCore Contribution Agreement 1.1 Signed-off-by: Rebecca Cran --- Readme.md | 117 +++++++++----------- 1 file changed, 52 insertions(+), 65 deletions(-) diff --git a/Readme.md b/Readme.md index e6d35fa41131..1e4a5d25bd6f 100644 --- a/Readme.md +++ b/Readme.md @@ -38,121 +38,108 @@ available when reading the **HTML** versions of the documents. Document issues a be entered in [Tianocore Bugzilla](https://bugzilla.tianocore.org). * **_EDK II Build Specification_** \[ -[HTML ](https://www.gitbook.com/read/book/edk2-docs/edk-ii-build-specification), -[PDF ](https://www.gitbook.com/download/pdf/book/edk2-docs/edk-ii-build-specification), -[Mobi ](https://www.gitbook.com/download/mobi/book/edk2-docs/edk-ii-build-specification), -[ePub ](https://www.gitbook.com/download/epub/book/edk2-docs/edk-ii-build-specification), -[Gitbook](https://www.gitbook.com/book/edk2-docs/edk-ii-build-specification), +[HTML ](https://tianocore-docs.github.io/edk2-BuildSpecification/draft/), +[PDF ](https://tianocore-docs.github.io/edk2-BuildSpecification/draft/edk2-BuildSpecification-draft.pdf), +[Mobi ](https://tianocore-docs.github.io/edk2-BuildSpecification/draft/edk2-BuildSpecification-draft.mobi), +[ePub ](https://tianocore-docs.github.io/edk2-BuildSpecification/draft/edk2-BuildSpecification-draft.epub), [GitHub ](https://github.com/tianocore-docs/edk2-BuildSpecification) \] * **_EDK II DEC Specification_** \[ -[HTML ](https://www.gitbook.com/read/book/edk2-docs/edk-ii-dec-specification), -[PDF ](https://www.gitbook.com/download/pdf/book/edk2-docs/edk-ii-dec-specification), -[Mobi ](https://www.gitbook.com/download/mobi/book/edk2-docs/edk-ii-dec-specification), -[ePub ](https://www.gitbook.com/download/epub/book/edk2-docs/edk-ii-dec-specification), -[Gitbook](https://www.gitbook.com/book/edk2-docs/edk-ii-dec-specification), +[HTML ](https://tianocore-docs.github.io/edk2-DecSpecification/draft/), +[PDF ](https://tianocore-docs.github.io/edk2-DecSpecification/draft/edk2-DecSpecification-draft.pdf), +[Mobi ](https://tianocore-docs.github.io/edk2-DecSpecification/draft/edk2-DecSpecification-draft.mobi), +[ePub ](https://tianocore-docs.github.io/edk2-DecSpecification/draft/edk2-DecSpecification-draft.epub), [GitHub ](https://github.com/tianocore-docs/edk2-DecSpecification) \] * **_EDK II INF Specification_** \[ -[HTML ](https://www.gitbook.com/read/book/edk2-docs/edk-ii-inf-specification), -[PDF ](https://www.gitbook.com/download/pdf/book/edk2-docs/edk-ii-inf-specification), -[Mobi ](https://www.gitbook.com/download/mobi/book/edk2-docs/edk-ii-inf-specification), -[ePub ](https://www.gitbook.com/download/epub/book/edk2-docs/edk-ii-inf-specification), -[Gitbook](https://www.gitbook.com/book/edk2-docs/edk-ii-inf-specification), +[HTML ](https://tianocore-docs.github.io/edk2-InfSpecification/draft/), +[PDF ](https://tianocore-docs.github.io/edk2-InfSpecification/draft/edk2-InfSpecification-draft.pdf), +[Mobi ](https://tianocore-docs.github.io/edk2-InfSpecification/draft/edk2-InfSpecification-draft.mobi), +[ePub ](https://tianocore-docs.github.io/edk2-InfSpecification/draft/edk2-InfSpecification-draft.epub), [GitHub ](https://github.com/tianocore-docs/edk2-InfSpecification) \] * **_EDK II DSC Specification_** \[ -[HTML ](https://www.gitbook.com/read/book/edk2-docs/edk-ii-dsc-specification), -[PDF ](https://www.gitbook.com/download/pdf/book/edk2-docs/edk-ii-dsc-specification), -[Mobi ](https://www.gitbook.com/download/mobi/book/edk2-docs/edk-ii-dsc-specification), -[ePub ](https://www.gitbook.com/download/epub/book/edk2-docs/edk-ii-dsc-specification), -[Gitbook](https://www.gitbook.com/book/edk2-docs/edk-ii-dsc-specification/details), +[HTML ](https://tianocore-docs.github.io/edk2-DscSpecification/draft/), +[PDF ](https://tianocore-docs.github.io/edk2-DscSpecification/draft/edk2-DscSpecification-draft.pdf), +[Mobi ](https://tianocore-docs.github.io/edk2-DscSpecification/draft/edk2-DscSpecification-draft.mobi), +[ePub ](https://tianocore-docs.github.io/edk2-DscSpecification/draft/edk2-DscSpecification-draft.epub), [GitHub ](https://github.com/tianocore-docs/edk2-DscSpecification) \] * **_EDK II FDF Specification_** \[ -[HTML ](https://www.gitbook.com/read/book/edk2-docs/edk-ii-fdf-specification), -[PDF ](https://www.gitbook.com/download/pdf/book/edk2-docs/edk-ii-fdf-specification), -[Mobi ](https://www.gitbook.com/download/mobi/book/edk2-docs/edk-ii-fdf-specification), -[ePub ](https://www.gitbook.com/download/epub/book/edk2-docs/edk-ii-fdf-specification), -[Gitbook](https://www.gitbook.com/book/edk2-docs/edk-ii-fdf-specification), +[HTML ](https://tianocore-docs.github.io/edk2-FdfSpecification/draft/), +[PDF ](https://tianocore-docs.github.io/edk2-FdfSpecification/draft/edk2-FdfSpecification-draft.pdf), +[Mobi ](https://tianocore-docs.github.io/edk2-FdfSpecification/draft/edk2-FdfSpecification-draft.mobi), +[ePub ](https://tianocore-docs.github.io/edk2-FdfSpecification/draft/edk2-FdfSpecification-draft.epub), [GitHub ](https://github.com/tianocore-docs/edk2-FdfSpecification) \] * **_EDK II UNI Specification_** \[ -[HTML ](https://www.gitbook.com/read/book/edk2-docs/edk-ii-uni-specification), -[PDF ](https://www.gitbook.com/download/pdf/book/edk2-docs/edk-ii-uni-specification), -[Mobi ](https://www.gitbook.com/download/mobi/book/edk2-docs/edk-ii-uni-specification), -[ePub ](https://www.gitbook.com/download/epub/book/edk2-docs/edk-ii-uni-specification), -[Gitbook](https://www.gitbook.com/book/edk2-docs/edk-ii-uni-specification), +[HTML ](https://tianocore-docs.github.io/edk2-UniSpecification/draft/), +[PDF ](https://tianocore-docs.github.io/edk2-UniSpecification/draft/edk2-UniSpecification-draft.pdf), +[Mobi ](https://tianocore-docs.github.io/edk2-UniSpecification/draft/edk2-UniSpecification-draft.mobi), +[ePub ](https://tianocore-docs.github.io/edk2-UniSpecification/draft/edk2-UniSpecification-draft.epub), [GitHub ](https://github.com/tianocore-docs/edk2-UniSpecification) \] * **_EDK II Image Definition IDF File Format Specification_** \[ -[HTML ](https://www.gitbook.com/read/book/edk2-docs/edk-ii-idf-specification), -[PDF ](https://www.gitbook.com/download/pdf/book/edk2-docs/edk-ii-idf-specification), -[Mobi ](https://www.gitbook.com/download/mobi/book/edk2-docs/edk-ii-idf-specification), -[ePub ](https://www.gitbook.com/download/epub/book/edk2-docs/edk-ii-idf-specification), -[Gitbook](https://www.gitbook.com/book/edk2-docs/edk-ii-idf-specification), +[HTML ](https://tianocore-docs.github.io/edk2-IdfSpecification/draft/), +[PDF ](https://tianocore-docs.github.io/edk2-IdfSpecification/draft/edk2-IdfSpecification-draft.pdf), +[Mobi ](https://tianocore-docs.github.io/edk2-IdfSpecification/draft/edk2-IdfSpecification-draft.mobi), +[ePub ](https://tianocore-docs.github.io/edk2-IdfSpecification/draft/edk2-IdfSpecification-draft.epub), [GitHub ](https://github.com/tianocore-docs/edk2-IdfSpecification) \] * **_EDK II VFR Specification_** \[ -[HTML ](https://www.gitbook.com/read/book/edk2-docs/edk-ii-vfr-specification), -[PDF ](https://www.gitbook.com/download/pdf/book/edk2-docs/edk-ii-vfr-specification), -[Mobi ](https://www.gitbook.com/download/mobi/book/edk2-docs/edk-ii-vfr-specification), -[ePub ](https://www.gitbook.com/download/epub/book/edk2-docs/edk-ii-vfr-specification), -[Gitbook](https://www.gitbook.com/book/edk2-docs/edk-ii-vfr-specification), +[HTML ](https://tianocore-docs.github.io/edk2-VfrSpecification/draft/), +[PDF ](https://tianocore-docs.github.io/edk2-VfrSpecification/draft/edk2-VfrSpecification-draft.pdf), +[Mobi ](https://tianocore-docs.github.io/edk2-VfrSpecification/draft/edk2-VfrSpecification-draft.mobi), +[ePub ](https://tianocore-docs.github.io/edk2-VfrSpecification/draft/edk2-VfrSpecification-draft.epub), [GitHub ](https://github.com/tianocore-docs/edk2-VfrSpecification) \] * **_EDK II Meta-Data Expression Syntax Specification_** \[ -[HTML ](https://www.gitbook.com/read/book/edk2-docs/edk-ii-meta-data-expression-syntax-specification), -[PDF ](https://www.gitbook.com/download/pdf/book/edk2-docs/edk-ii-meta-data-expression-syntax-specification), -[Mobi ](https://www.gitbook.com/download/mobi/book/edk2-docs/edk-ii-meta-data-expression-syntax-specification), -[ePub ](https://www.gitbook.com/download/epub/book/edk2-docs/edk-ii-meta-data-expression-syntax-specification), -[Gitbook](https://www.gitbook.com/book/edk2-docs/edk-ii-meta-data-expression-syntax-specification), +[HTML ](https://tianocore-docs.github.io/edk2-MetaDataExpressionSyntaxSpecification/draft/), +[PDF ](https://tianocore-docs.github.io/edk2-MetaDataExpressionSyntaxSpecification/draft/edk2-MetaDataExpressionSyntaxSpecification-draft.pdf), +[Mobi ](https://tianocore-docs.github.io/edk2-MetaDataExpressionSyntaxSpecification/draft/edk2-MetaDataExpressionSyntaxSpecification-draft.mobi), +[ePub ](https://tianocore-docs.github.io/edk2-MetaDataExpressionSyntaxSpecification/draft/edk2-MetaDataExpressionSyntaxSpecification-draft.epub), [GitHub ](https://github.com/tianocore-docs/edk2-MetaDataExpressionSyntaxSpecification) \] * **_EDK II PCD Specification_** \[ -[HTML ](https://www.gitbook.com/read/book/edk2-docs/edk-ii-pcd-specification), -[PDF ](https://www.gitbook.com/download/pdf/book/edk2-docs/edk-ii-pcd-specification), -[Mobi ](https://www.gitbook.com/download/mobi/book/edk2-docs/edk-ii-pcd-specification), -[ePub ](https://www.gitbook.com/download/epub/book/edk2-docs/edk-ii-pcd-specification), -[Gitbook](https://www.gitbook.com/book/edk2-docs/edk-ii-pcd-specification), +[HTML ](https://tianocore-docs.github.io/edk2-PcdSpecification/draft/), +[PDF ](https://tianocore-docs.github.io/edk2-PcdSpecification/draft/edk2-PcdSpecification-draft.pdf), +[Mobi ](https://tianocore-docs.github.io/edk2-PcdSpecification/draft/edk2-PcdSpecification-draft.mobi), +[ePub ](https://tianocore-docs.github.io/edk2-PcdSpecification/draft/edk2-PcdSpecification-draft.epub), [GitHub ](https://github.com/tianocore-docs/edk2-PcdSpecification) \] * **_EDK II C Coding Standards Specification_** \[ -[HTML ](https://www.gitbook.com/read/book/edk2-docs/edk-ii-c-coding-standards-specification), -[PDF ](https://www.gitbook.com/download/pdf/book/edk2-docs/edk-ii-c-coding-standards-specification), -[Mobi ](https://www.gitbook.com/download/mobi/book/edk2-docs/edk-ii-c-coding-standards-specification), -[ePub ](https://www.gitbook.com/download/epub/book/edk2-docs/edk-ii-c-coding-standards-specification), -[Gitbook](https://www.gitbook.com/book/edk2-docs/edk-ii-c-coding-standards-specification), +[HTML ](https://tianocore-docs.github.io/edk2-CCodingStandardsSpecification/draft/), +[PDF ](https://tianocore-docs.github.io/edk2-CCodingStandardsSpecification/draft/edk2-CCodingStandardsSpecification-draft.pdf), +[Mobi ](https://tianocore-docs.github.io/edk2-CCodingStandardsSpecification/draft/edk2-CCodingStandardsSpecification-draft.mobi), +[ePub ](https://tianocore-docs.github.io/edk2-CCodingStandardsSpecification/draft/edk2-CCodingStandardsSpecification-draft.epub), [GitHub ](https://github.com/tianocore-docs/edk2-CCodingStandardsSpecification) \] * **_EDK II Driver Writer's Guide for UEFI 2.3.1_** \[ -[HTML ](https://edk2-docs.gitbooks.io/edk-ii-uefi-driver-writer-s-guide/content), -[PDF ](https://legacy.gitbook.com/download/pdf/book/edk2-docs/edk-ii-uefi-driver-writer-s-guide), -[Mobi ](https://legacy.gitbook.com/download/mobi/book/edk2-docs/edk-ii-uefi-driver-writer-s-guide), -[ePub ](https://legacy.gitbook.com/download/epub/book/edk2-docs/edk-ii-uefi-driver-writer-s-guide), -[Gitbook](https://legacy.gitbook.com/book/edk2-docs/edk-ii-uefi-driver-writer-s-guide), +[HTML ](https://tianocore-docs.github.io/edk2-UefiDriverWritersGuide/draft/), +[PDF ](https://tianocore-docs.github.io/edk2-UefiDriverWritersGuide/draft/edk2-UefiDriverWritersGuide-draft.pdf), +[Mobi ](https://tianocore-docs.github.io/edk2-UefiDriverWritersGuide/draft/edk2-UefiDriverWritersGuide-draft.mobi), +[ePub ](https://tianocore-docs.github.io/edk2-UefiDriverWritersGuide/draft/edk2-UefiDriverWritersGuide-draft.epub), [GitHub ](https://github.com/tianocore-docs/edk2-UefiDriverWritersGuide) \] --- * **_EDK II Template Specification_** \[ -[HTML ](https://www.gitbook.com/read/book/edk2-docs/edk-ii-template-specification), -[PDF ](https://www.gitbook.com/download/pdf/book/edk2-docs/edk-ii-template-specification), -[Mobi ](https://www.gitbook.com/download/mobi/book/edk2-docs/edk-ii-template-specification), -[ePub ](https://www.gitbook.com/download/epub/book/edk2-docs/edk-ii-template-specification), -[Gitbook](https://www.gitbook.com/book/edk2-docs/edk-ii-template-specification), +[HTML ](https://tianocore-docs.github.io/edk2-TemplateSpecification/draft/), +[PDF ](https://tianocore-docs.github.io/edk2-TemplateSpecification/draft/edk2-TemplateSpecification-draft.pdf), +[Mobi ](https://tianocore-docs.github.io/edk2-TemplateSpecification/draft/edk2-TemplateSpecification-draft.mobi), +[ePub ](https://tianocore-docs.github.io/edk2-TemplateSpecification/draft/edk2-TemplateSpecification-draft.epub), [GitHub ](https://github.com/tianocore-docs/edk2-TemplateSpecification) \] -- 2.37.1 (Apple Git-137.1)